PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00121.1_g00044.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 271aa    MW: 30451.4 Da    PI: 8.5535
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00121.1_g00044.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.61e-52141391128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrF Ptdeel+v+yL++kv+g +++l ++i ++d+yk++PwdLp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkat
  Rsa1.0_00121.1_g00044.1  14 LPPGFRFYPTDEELLVQYLCRKVAGYHFSL-QIIGDIDLYKFDPWDLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKAT 98 
                              79***************************9.89***************8777899******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk ++s +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl
  Rsa1.0_00121.1_g00044.1  99 GTDKVITS-DGHRVGIKKALVFYAGKAPKGTKTNWIMHEYRL 139
                              *******9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-679162IPR003441NAC domain
PROSITE profilePS5100560.91714162IPR003441NAC domain
PfamPF023654.2E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGVREKDPLA QLSLPPGFRF YPTDEELLVQ YLCRKVAGYH FSLQIIGDID LYKFDPWDLP  60
SKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVITSDGHR VGIKKALVFY  120
AGKAPKGTKT NWIMHEYRLI EHSRSHGSSK LDDWVLCRIY YKKMSGSQQR QAVVAPVQAC  180
LEDQSTNVSP SSSSSQLDDV LDSFPEMKDG SFNLPRMNSL RTILNGNFDW ASLAGLNPIP  240
ELAPALELSN YGGYQSFQSA ESGCRNSHFA G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-10511697174NAC domain-containing protein 19
3swm_B1e-10511697174NAC domain-containing protein 19
3swm_C1e-10511697174NAC domain-containing protein 19
3swm_D1e-10511697174NAC domain-containing protein 19
3swp_A1e-10511697174NAC domain-containing protein 19
3swp_B1e-10511697174NAC domain-containing protein 19
3swp_C1e-10511697174NAC domain-containing protein 19
3swp_D1e-10511697174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667560.0KC966756.1 Brassica napus NAC transcription factor 72 (NAC72.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009143398.11e-177PREDICTED: NAC domain-containing protein 72-like
RefseqNP_001302512.11e-177NAC domain-containing protein 72-like
SwissprotQ93VY31e-171NAC72_ARATH; NAC domain-containing protein 72
TrEMBLA0A078DPW41e-177A0A078DPW4_BRANA; BnaA01g16400D protein
TrEMBLM4EC441e-177M4EC44_BRARP; Uncharacterized protein
STRINGBra026353.1-P1e-176(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-154NAC family protein